3.33 Rating by CuteStat

chamundistructurals.com is 5 years 9 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, chamundistructurals.com is SAFE to browse.

PageSpeed Score
100
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

209.59.154.197

Hosted Country:

United States of America US

Location Latitude:

42.7376

Location Longitude:

-84.6244

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 209.59.154.197)

Neopia Solutions | Best Interior

- neopiainteriors.com
Not Applicable $ 8.95

Sairam Shipbrokers

- sairamshipbrokers.com
Not Applicable $ 8.95

Sree RajGuru Impex | Tale of an Indian Agro Exporter

- sreerajguruimpex.com
Not Applicable $ 8.95

Lakshmi Narayanan | Medical Equipments

- lakshminarayananmedicalequipments.com
Not Applicable $ 8.95

Index of /

- lakshminarayananfinancialservices.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 01 Aug 2018 14:43:04 GMT
Server: Apache
Cache-Control: max-age=600
Expires: Wed, 01 Aug 2018 14:53:04 GMT
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 358
Content-Type: text/html;charset=ISO-8859-1

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: Jul 30, 2018, 12:00 AM 5 years 9 months 1 week ago
Last Modified: Jul 30, 2018, 12:00 AM 5 years 9 months 1 week ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns1.dezvolta.com 103.120.176.21 India India
ns2.dezvolta.com 103.120.176.21 India India

DNS Record Analysis

Host Type TTL Extra
chamundistructurals.com A 10798 IP: 209.59.154.197
chamundistructurals.com NS 86400 Target: ns1.dezvolta.com
chamundistructurals.com NS 86400 Target: ns2.dezvolta.com
chamundistructurals.com SOA 10800 MNAME: ns1.dezvolta.com
RNAME: anand.dezvolta.com
Serial: 2018073008
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
chamundistructurals.com MX 14400 Priority: 1
Target: aspmx.l.google.com
chamundistructurals.com MX 14400 Priority: 5
Target: alt1.aspmx.l.google.com
chamundistructurals.com MX 14400 Priority: 5
Target: alt2.aspmx.l.google.com
chamundistructurals.com MX 14400 Priority: 10
Target: alt3.aspmx.l.google.com
chamundistructurals.com MX 14400 Priority: 10
Target: alt4.aspmx.l.google.com
chamundistructurals.com TXT 14400 TXT: v=spf1 +a +mx +ip4:209.59.154.197 ~all

Full WHOIS Lookup

Domain Name: CHAMUNDISTRUCTURALS.COM
Registry Domain ID: 2291711396_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2018-07-30T10:37:58Z
Creation Date: 2018-07-30T10:32:59Z
Registry Expiry Date: 2019-07-30T10:32:59Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.DEZVOLTA.COM
Name Server: NS2.DEZVOLTA.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-08-01T14:42:56Z